PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462883690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 322aa    MW: 35987.2 Da    PI: 5.6792
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462883690genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.4e-092412742255
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +yps+ e++ LA+++gL+ +q+ +WF N+R ++
  462883690 241 WPYPSELEKAALAESTGLDSKQINNWFINQRKRH 274
                59*****************************885 PP

2ELK35.32.5e-12194215122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK++Ll+KYsgyL+sL+ E+s
  462883690 194 ELKNRLLNKYSGYLSSLWRELS 215
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-1958102IPR005540KNOX1
PfamPF037901.7E-2060100IPR005540KNOX1
SMARTSM012564.7E-21106157IPR005541KNOX2
PfamPF037914.5E-19112155IPR005541KNOX2
SMARTSM011889.5E-7194215IPR005539ELK domain
PROSITE profilePS5121310.51194214IPR005539ELK domain
PfamPF037891.4E-9194215IPR005539ELK domain
PROSITE profilePS5007112.536214277IPR001356Homeobox domain
SuperFamilySSF466893.46E-18216285IPR009057Homeodomain-like
SMARTSM003897.7E-11216281IPR001356Homeobox domain
CDDcd000861.54E-12217277No hitNo description
Gene3DG3DSA:1.10.10.601.7E-25219278IPR009057Homeodomain-like
PfamPF059209.9E-16234273IPR008422Homeobox KN domain
PROSITE patternPS000270252275IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MEQPLPLLAS SSKSTTTPFY LALDQRAITA SSPPGEASTP PSDASDPSRQ SNNEGGSEII  60
KAKIMSHPLY PALLRAFIDC RKVGAPPEIV GRLSALAGEV EMNSNDRQEQ PEDPELDQFM  120
EMYCHALERY RQELTRPIHE ADEFFRTMEA QIESFVLDDK SCELGGGGSS EEDEQETGID  180
AGGLPAETSE EDKELKNRLL NKYSGYLSSL WRELSRKKKK GKLPRDARQK LLHWWQLHYR  240
WPYPSELEKA ALAESTGLDS KQINNWFINQ RKRHWKPAPP PMLVAPDYRL QPHGGASSSS  300
AQAAPRADGH YFTGGSAYSR GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0406220.0BT040622.1 Zea mays full-length cDNA clone ZM_BFc0104L02 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982196.11e-167PREDICTED: homeobox protein knotted-1-like 4
SwissprotQ75LX71e-134KNOS4_ORYSJ; Homeobox protein knotted-1-like 4
TrEMBLK4ACH31e-167K4ACH3_SETIT; Uncharacterized protein
STRINGSi036580m1e-167(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.16e-74KNOTTED-like from Arabidopsis thaliana